PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10004873m
Common NameCARUB_v10004873mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 427aa    MW: 48759.5 Da    PI: 7.4961
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10004873mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-1884131148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT eEd++lvd+++++G g+W+t ++  g+ R++k+c++rw +yl
  Carubv10004873m  84 KGPWTSEEDQKLVDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 131
                      79********************************************97 PP

2Myb_DNA-binding51.62.2e-16137181147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  Carubv10004873m 137 RGRFSFEEEETIIQLHSFLGNK-WSAIAARLP-GRTDNEIKNFWNTH 181
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.8E-2675134IPR009057Homeodomain-like
PROSITE profilePS5129424.63279135IPR017930Myb domain
SuperFamilySSF466893.04E-3181178IPR009057Homeodomain-like
SMARTSM007175.5E-1383133IPR001005SANT/Myb domain
PfamPF002494.6E-1684131IPR001005SANT/Myb domain
CDDcd001675.33E-1286131No hitNo description
Gene3DG3DSA:1.10.10.607.3E-26135186IPR009057Homeodomain-like
PROSITE profilePS5129419.234136186IPR017930Myb domain
SMARTSM007171.4E-15136184IPR001005SANT/Myb domain
PfamPF002498.6E-15137181IPR001005SANT/Myb domain
CDDcd001672.37E-11139182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MRNRGRHRTI LTSHLVRSLY ILCTSPYGPY DLFVSLFSLY SYPLTSLKLS HLLLNQLTIL  60
FPYKQSSSIS MARSPCCEKN GLKKGPWTSE EDQKLVDYIQ KHGYGNWRTL PKNAGLQRCG  120
KSCRLRWTNY LRPDIKRGRF SFEEEETIIQ LHSFLGNKWS AIAARLPGRT DNEIKNFWNT  180
HIRKKLLRMG IDPVTHSPRL DLLDISSILA SSLYNSSSSH HMNMSGLMMD THRRHQHQNP  240
LVNPEILKLA TSLFSQNQNH NQNLVVDHDS RTQGKQPVYH QHDVNQAGVN QYQTDQYFEN  300
TITQELQSSM PPFPNEAHQF DHMDHHFNGF GEQTLASTST TSVQDCNNLS TFNDYSSSNY  360
VLDPDQSFNF ANSVLNTPSS SPSPTTLNSS YINSSSCSTE DEIESYCSNL MKFDIPDFLD  420
VNGFII*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31821865108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0872520.0AY087252.1 Arabidopsis thaliana clone 33333 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283783.10.0hypothetical protein CARUB_v10004873mg
TrEMBLR0F5E60.0R0F5E6_9BRAS; Uncharacterized protein
STRINGAT4G21440.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.10.0MYB-like 102